PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G356000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 320aa    MW: 33661.9 Da    PI: 8.1503
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G356000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Sobic.001G356000.1.p 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPGNTGLLRCSKSCRLRWTNYL 61
                          79******************************99************97 PP

2Myb_DNA-binding46.67.7e-1567112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg ++  Ed l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.001G356000.1.p  67 RGGFSDHEDRLIVHLQALLGNR-WAAIASYLP-DRTDNDVKNYWNTHL 112
                           7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.64965IPR017930Myb domain
SuperFamilySSF466891.27E-2911108IPR009057Homeodomain-like
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
PfamPF002495.5E-161461IPR001005SANT/Myb domain
CDDcd001673.20E-111661No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2365116IPR009057Homeodomain-like
SMARTSM007175.4E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.11466116IPR017930Myb domain
PfamPF002494.3E-1367112IPR001005SANT/Myb domain
CDDcd001676.81E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PGNTGLLRCS KSCRLRWTNY  60
LRPGIRRGGF SDHEDRLIVH LQALLGNRWA AIASYLPDRT DNDVKNYWNT HLKKKLLLQH  120
QQRQRASTAA ASSLPSPSKG QWELKLQTDI DLARRALRDA LSVDAAAGPP GMAAAGSAPT  180
AAPAQPYAPT ARSVDGMLLD GWAAAPAAGR SCAVVGGTVI PAPAPATPPG ATDSTSGSSS  240
VLTTECSGSI SSASNKRAAP PVAAGHRLLL VHEENSTSAG QGEVPLSAIE SWLLEDAGGE  300
QKLPHESLLL DAALHNFGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-26141164105C-Myb DNA-Binding Domain
1mse_C2e-26141164105C-Myb DNA-Binding Domain
1gv2_A2e-26141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9628480.0EU962848.1 Zea mays clone 246006 myb transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149309.11e-147myb transcription factor MYB30
RefseqXP_008658625.11e-147PREDICTED: myb transcription factor MYB30 isoform X1
SwissprotP813921e-93MYB06_ANTMA; Myb-related protein 306
TrEMBLB6TCY31e-147B6TCY3_MAIZE; Myb transcription factor MYB30
STRINGGRMZM2G098179_P011e-147(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.13e-79myb domain protein 94